PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_06685_BGI-A2_v1.0
Common NameF383_19355
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YA
Protein Properties Length: 337aa    MW: 37047.6 Da    PI: 9.8397
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_06685_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA1002.4e-31187243158
                   CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                                 d p+YVNaKQy++Il+RR  Rakle+++kl  ksrkpylheSRh hAl+R RgsgGrF
  Cotton_A_06685_BGI-A2_v1.0 187 DGPVYVNAKQYHGILRRRRYRAKLEAQNKL-VKSRKPYLHESRHLHALNRVRGSGGRF 243
                                 57****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005214.5E-35185246IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.5186246IPR001289Nuclear transcription factor Y subunit A
PfamPF020459.0E-27189243IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006165.5E-23189211IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860191211IPR018362CCAAT-binding factor, conserved site
PRINTSPR006165.5E-23220243IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MSYMAVRIQS LSKKNFDERF SIFSLPHISV GFQPWWNSNE QKIAHSLPQN ISLKVETPSK  60
LHHNAKHLDH QLPDLESTSA QAIGQSRLEM GVTRGSNPSF YSSDFGEDES CGKDIEGQMK  120
PINNPNTVFS PSNPNYNLSM ASAQYPYADI CIGGLFTPYG QPAIIQAQMA RGSAPARLPL  180
PLDLAEDGPV YVNAKQYHGI LRRRRYRAKL EAQNKLVKSR KPYLHESRHL HALNRVRGSG  240
GRFLSKKKLQ QPHHPTSNPS SRSISDASCL DRKNSGSELG SHLHVGGCSS SSTSCSDISS  300
ASNNNGSFQL RKQGFIDISP GVRSMCNGIQ NCASVGL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A4e-21187253268NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012450139.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like isoform X1
RefseqXP_012450140.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like isoform X1
RefseqXP_012450141.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like isoform X1
RefseqXP_012450142.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like isoform X1
TrEMBLA0A0B0MNU50.0A0A0B0MNU5_G
STRINGPOPTR_0006s14740.14e-95(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2440034
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.25e-34nuclear factor Y, subunit A7